PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g040125m
Common NameCISIN_1g040125mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 515aa    MW: 57257.6 Da    PI: 7.4414
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g040125mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS372.94.1e-1141415131374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn...sseelaalklfsevs 88 
                        lv+lL++cAeav+ +d++ a+alL++l+ +a   g+++qR+a++f+++La rla+ +  + + +++ps +  ++   s e+  a++l +e++
  orange1.1g040125m 141 LVQLLIACAEAVACRDKSHASALLSELRANALVFGSSFQRVASCFVQGLADRLASvQPLGAVGSFAPSMNI-MDiagSREKEEAFRLVYEIC 231
                        689***************************************************93223344444443333.2257899999********** PP

               GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGl....QWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvp 175
                        P ++f+h++aN+ Ilea+ege+ vH++D++++ Gl    QW  L+++La+R+++pp +lRiT+vg       e+ +++g+ L+++A++ g++
  orange1.1g040125m 232 PHIQFGHFVANSSILEAFEGESFVHVVDLGMTLGLprgqQWRRLIESLANRAGQPPrRLRITAVGL----CVEKFQSIGDELKDYAKTYGIN 319
                        *****************************9886533333*************877779********....********************** PP

               GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                        +ef+v v+++le+l++++++v ++E+l+Vn++lqlh +++es    +   +vL+++ +lsPkv+v+veq+++hn++ Fl rf+eal+yysa+
  orange1.1g040125m 320 LEFSV-VESNLENLQTKDIKVLENEVLVVNSILQLHCVVKESRGALN---SVLQIIHELSPKVLVLVEQDSSHNGPFFLGRFMEALHYYSAI 407
                        ****9.7********************************88877777...8***************************************** PP

               GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgsl 358
                        fdsl+a lp+ + +r+k+E++++++ei+n+v+ceg +r+erhe++ +Wr+r+++aGF+++p++  + +qa+  l++ k  +gy+v ee+g+l
  orange1.1g040125m 408 FDSLDAMLPKYDTKRAKIEQFYFAEEIKNIVSCEGPARVERHERVDQWRRRMSRAGFQAAPMK--MINQAQKWLKNNKvCEGYTVVEEKGCL 497
                        *************************************************************96..678999999999999************ PP

               GRAS 359 vlgWkdrpLvsvSaWr 374
                        vlgWk++p++++S+W+
  orange1.1g040125m 498 VLGWKSKPIIATSCWK 513
                        ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.139115494IPR005202Transcription factor GRAS
PfamPF035141.4E-111141513IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MVYDFLFNTH KLYNDQRSNQ AIGLQLGLSI VDCYPYLPMM SDNSAASSMM LQPRDQKRLK  60
RTISVADSIA GDGSPTSTLS RSSSSSSLSN LPRLQFRDHI WTYTQRYLAA EAVEEAAAAM  120
TKAVDGCGGD QQDGTADGMR LVQLLIACAE AVACRDKSHA SALLSELRAN ALVFGSSFQR  180
VASCFVQGLA DRLASVQPLG AVGSFAPSMN IMDIAGSREK EEAFRLVYEI CPHIQFGHFV  240
ANSSILEAFE GESFVHVVDL GMTLGLPRGQ QWRRLIESLA NRAGQPPRRL RITAVGLCVE  300
KFQSIGDELK DYAKTYGINL EFSVVESNLE NLQTKDIKVL ENEVLVVNSI LQLHCVVKES  360
RGALNSVLQI IHELSPKVLV LVEQDSSHNG PFFLGRFMEA LHYYSAIFDS LDAMLPKYDT  420
KRAKIEQFYF AEEIKNIVSC EGPARVERHE RVDQWRRRMS RAGFQAAPMK MINQAQKWLK  480
NNKVCEGYTV VEEKGCLVLG WKSKPIIATS CWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-511415134375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0725920.0GU072592.1 Citrus trifoliata GRAS family transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476980.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067G0U00.0A0A067G0U0_CITSI; Uncharacterized protein
STRINGPOPTR_0015s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16018814
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-78RGA-like 1